PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G001000.1
Common NamePOPTR_0013s00290g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 447aa    MW: 49423.1 Da    PI: 7.6981
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G001000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.3e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Potri.013G001000.1 14 KGLWSPEEDEKLLNYITKHGLGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding44.44e-1467110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Potri.013G001000.1  67 RGAFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                         89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-26664IPR009057Homeodomain-like
PROSITE profilePS5129424.959965IPR017930Myb domain
SuperFamilySSF466892.4E-2912108IPR009057Homeodomain-like
SMARTSM007174.9E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001677.55E-121761No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129420.12666116IPR017930Myb domain
SMARTSM007172.9E-1266114IPR001005SANT/Myb domain
PfamPF002494.8E-1367110IPR001005SANT/Myb domain
CDDcd001674.30E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGLGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKSLS EAEDGKGKQQ LTADKSNEKV SIVSNELNLI KTATLKPPAV SSRSSNVITT  180
NNNKDRSGSS NLTNVPPTQE FFLDRFGTSH ESSTTASCMP SDLMDYFPFQ KLDYKPIIDL  240
SMNPNSTLCF NPNSSSSEMI SHEFNSSMTP PTILPSVSTS MFQTPICVKP SVSLPSDHNP  300
SVGSCDVNGV QNWEASSFSN NGSGSNGSSS SIELQSNTNF FESSAFSWGL ADCGKSSDEA  360
HLRSLANETV EDIKWSEYLS TPFFLGSTIQ NQTSQHVYSE VKPETHFIAQ GSSTSWLKNQ  420
HQQASQPADI YTKDLQRLAV AFGQSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8017490.0JQ801749.1 Populus tomentosa putative transcription factor (MYB216) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319449.10.0hypothetical protein POPTR_0013s00290g
TrEMBLB9I6B70.0B9I6B7_POPTR; Uncharacterized protein
STRINGPOPTR_0013s00290.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-132myb domain protein 61